SCOPe 2.08: Domain d6sxxb_: 6sxx B:

Lineage for d6sxxb_ (6sxx B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein automated matches [190366] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (46 PDB entries)

8. Domain d6sxxb_: 6sxx B: [391751]
   automated match to d4nyxa_
   complexed with edo, lxq

Details for d6sxxb_

PDB Entry: 6sxx, 2.01 Å

PDB Description: crystal structure of the bromodomain of human crebbp in complex with aca007

PDB Compounds: (B:) crebbp

SCOPe Domain Sequences for d6sxxb_:

Sequence; same for both SEQRES and ATOM records:

>d6sxxb_ a.29.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkld
tgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

Timeline for d6sxxb_:

• d6sxxb_ first appeared in SCOPe 2.07