SCOP 1.73: Domain d3sxla2: 3sxl A:206-289

Lineage for d3sxla2 (3sxl A:206-289)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families)

5. Family d.58.7.1: Canonical RBD [54929] (67 proteins)

6. Protein Sex-lethal protein [54938] (1 species)

7. Species Drosophila melanogaster [TaxId:7227] [54939] (4 PDB entries)

8. Domain d3sxla2: 3sxl A:206-289 [39174]

Details for d3sxla2

PDB Entry: 3sxl, 2.7 Å

PDB Description: sex-lethal rna recognition domains 1 and 2 from drosophila melanogaster

PDB Compounds: (A:) protein (sex-lethal)

SCOP Domain Sequences for d3sxla2:

Sequence, based on SEQRES records:

>d3sxla2 d.58.7.1 (A:206-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}
esikdtnlyvtnlprtitddqldtifgkygsivqknilrdkltgrprgvafvrynkreea
qeaisalnnvipeggsqplsvrla

Sequence, based on observed residues (ATOM records):

>d3sxla2 d.58.7.1 (A:206-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}
esikdtnlyvtnlprtitddqldtifgkygsivqknilrdkltgrprgvafvrynkreea
qeaisalnnvplsvrla

Timeline for d3sxla2:

• d3sxla2 first appeared (with stable ids) in SCOP 1.55
  
• d3sxla2 appears in SCOP 1.71
  
• d3sxla2 appears in SCOP 1.75
  
• d3sxla2 appears in the current release, SCOPe 2.08