Lineage for d3sxla2 (3sxl A:206-289)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2174486Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2174487Family d.58.7.1: Canonical RBD [54929] (68 protein domains)
  6. 2174779Protein Sex-lethal protein [54938] (1 species)
  7. 2174780Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [54939] (4 PDB entries)
  8. 2174786Domain d3sxla2: 3sxl A:206-289 [39174]

Details for d3sxla2

PDB Entry: 3sxl (more details), 2.7 Å

PDB Description: sex-lethal rna recognition domains 1 and 2 from drosophila melanogaster
PDB Compounds: (A:) protein (sex-lethal)

SCOPe Domain Sequences for d3sxla2:

Sequence, based on SEQRES records: (download)

>d3sxla2 d.58.7.1 (A:206-289) Sex-lethal protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
esikdtnlyvtnlprtitddqldtifgkygsivqknilrdkltgrprgvafvrynkreea
qeaisalnnvipeggsqplsvrla

Sequence, based on observed residues (ATOM records): (download)

>d3sxla2 d.58.7.1 (A:206-289) Sex-lethal protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
esikdtnlyvtnlprtitddqldtifgkygsivqknilrdkltgrprgvafvrynkreea
qeaisalnnvplsvrla

SCOPe Domain Coordinates for d3sxla2:

Click to download the PDB-style file with coordinates for d3sxla2.
(The format of our PDB-style files is described here.)

Timeline for d3sxla2: