Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families) |
Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
Protein Splicing factor U2B'' [54934] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54935] (1 PDB entry) |
Domain d1a9nb_: 1a9n B: [39165] Other proteins in same PDB: d1a9na_, d1a9nc_ |
PDB Entry: 1a9n (more details), 2.38 Å
SCOP Domain Sequences for d1a9nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9nb_ d.58.7.1 (B:) Splicing factor U2B'' {Human (Homo sapiens) [TaxId: 9606]} irpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelgss tnalrqlqgfpfygkpmriqyaktdsdiiskmrg
Timeline for d1a9nb_: