SCOP 1.75: Domain d1a9nb_: 1a9n B:

Lineage for d1a9nb_ (1a9n B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families)

5. Family d.58.7.1: Canonical RBD [54929] (67 proteins)

6. Protein Splicing factor U2B'' [54934] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54935] (1 PDB entry)

8. Domain d1a9nb_: 1a9n B: [39165]
   Other proteins in same PDB: d1a9na_, d1a9nc_

Details for d1a9nb_

PDB Entry: 1a9n, 2.38 Å

PDB Description: crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna

PDB Compounds: (B:) spliceosomal u2b''

SCOP Domain Sequences for d1a9nb_:

Sequence; same for both SEQRES and ATOM records:

>d1a9nb_ d.58.7.1 (B:) Splicing factor U2B'' {Human (Homo sapiens) [TaxId: 9606]}
irpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelgss
tnalrqlqgfpfygkpmriqyaktdsdiiskmrg

Timeline for d1a9nb_:

• d1a9nb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a9nb_ appears in SCOP 1.73
  
• d1a9nb_ appears in SCOPe 2.01
  
• d1a9nb_ appears in the current release, SCOPe 2.08