Lineage for d1a9nb_ (1a9n B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32639Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) (S)
  5. 32640Family d.58.7.1: Canonical RBD [54929] (12 proteins)
  6. 32727Protein Splicing factor U2B'' [54934] (1 species)
  7. 32728Species Human (Homo sapiens) [TaxId:9606] [54935] (1 PDB entry)
  8. 32729Domain d1a9nb_: 1a9n B: [39165]
    Other proteins in same PDB: d1a9na_, d1a9nc_

Details for d1a9nb_

PDB Entry: 1a9n (more details), 2.38 Å

PDB Description: crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna

SCOP Domain Sequences for d1a9nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9nb_ d.58.7.1 (B:) Splicing factor U2B'' {Human (Homo sapiens)}
irpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelgss
tnalrqlqgfpfygkpmriqyaktdsdiiskmrg

SCOP Domain Coordinates for d1a9nb_:

Click to download the PDB-style file with coordinates for d1a9nb_.
(The format of our PDB-style files is described here.)

Timeline for d1a9nb_: