Lineage for d1a9nb_ (1a9n B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952180Protein Spliceosomal U2 small nuclear ribonucleoprotein B' / U2B' / Msl1 protein [54934] (2 species)
    3jb9 chain k is Msl1 from fission yeast; not included because sids are not case sensitive
  7. 2952181Species Human (Homo sapiens) [TaxId:9606] [54935] (1 PDB entry)
  8. 2952182Domain d1a9nb_: 1a9n B: [39165]
    Other proteins in same PDB: d1a9na_, d1a9nc_
    protein/RNA complex

Details for d1a9nb_

PDB Entry: 1a9n (more details), 2.38 Å

PDB Description: crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna
PDB Compounds: (B:) spliceosomal u2b''

SCOPe Domain Sequences for d1a9nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9nb_ d.58.7.1 (B:) Spliceosomal U2 small nuclear ribonucleoprotein B' / U2B' / Msl1 protein {Human (Homo sapiens) [TaxId: 9606]}
irpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelgss
tnalrqlqgfpfygkpmriqyaktdsdiiskmrg

SCOPe Domain Coordinates for d1a9nb_:

Click to download the PDB-style file with coordinates for d1a9nb_.
(The format of our PDB-style files is described here.)

Timeline for d1a9nb_: