Lineage for d1up1_2 (1up1 99-182)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.58: Ferredoxin-like [54861] (39 superfamilies) 
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) 
Family d.58.7.1: Canonical RBD [54929] (13 proteins) 
Protein Nuclear ribonucleoprotein A1, RNP A1, UP1 [54930] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54931] (3 PDB entries) 
Domain d1up1_2: 1up1 99-182 [39150]
Details for d1up1_2
PDB Entry: 1up1 (more details), 1.9 Å
PDB Description: up1, the two rna-recognition motif domain of hnrnp a1
SCOP Domain Sequences for d1up1_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1up1_2 d.58.7.1 (99-182) Nuclear ribonucleoprotein A1, RNP A1, UP1 {Human (Homo sapiens)}
gahltvkkifvggikedteehhlrdyfeqygkievieimtdrgsgkkrgfafvtfddhds
vdkiviqkyhtvnghncevrkals
SCOP Domain Coordinates for d1up1_2:
Click to download the PDB-style file with coordinates for d1up1_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1up1_2:
- d1up1_2 first appeared (with stable ids) in SCOP 1.55
- d1up1_2 appears in SCOP 1.57
- d1up1_2 appears in SCOP 1.61
- d1up1_2 appears in the current release, SCOPe 2.08, called d1up1a2
View in 3D
