SCOP 1.63: Domain d1ha1_1: 1ha1 8-92

Lineage for d1ha1_1 (1ha1 8-92)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families)

5. Family d.58.7.1: Canonical RBD [54929] (14 proteins)

6. Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54931] (4 PDB entries)

8. Domain d1ha1_1: 1ha1 8-92 [39147]

Details for d1ha1_1

PDB Entry: 1ha1, 1.75 Å

PDB Description: hnrnp a1 (rbd1,2) from homo sapiens

SCOP Domain Sequences for d1ha1_1:

Sequence; same for both SEQRES and ATOM records:

>d1ha1_1 d.58.7.1 (8-92) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens)}
epeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatveev
daamnarphkvdgrvvepkravsre

Timeline for d1ha1_1:

• d1ha1_1 first appeared (with stable ids) in SCOP 1.55
  
• d1ha1_1 appears in SCOP 1.61
  
• d1ha1_1 appears in SCOP 1.65
  
• d1ha1_1 appears in the current release, SCOPe 2.08, called d1ha1a1