Lineage for d1nlkr_ (1nlk R:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724239Species Myxococcus xanthus [TaxId:34] [54927] (3 PDB entries)
  8. 724245Domain d1nlkr_: 1nlk R: [39145]

Details for d1nlkr_

PDB Entry: 1nlk (more details), 2 Å

PDB Description: crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution
PDB Compounds: (R:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d1nlkr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlkr_ d.58.6.1 (R:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]}
aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
lenakieiayffreteihsypyq

SCOP Domain Coordinates for d1nlkr_:

Click to download the PDB-style file with coordinates for d1nlkr_.
(The format of our PDB-style files is described here.)

Timeline for d1nlkr_: