SCOP 1.73: Domain d1nlkl_: 1nlk L:

Lineage for d1nlkl_ (1nlk L:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)

7. Species Myxococcus xanthus [TaxId:34] [54927] (3 PDB entries)

8. Domain d1nlkl_: 1nlk L: [39146]
   complexed with adp, mg

Details for d1nlkl_

PDB Entry: 1nlk, 2 Å

PDB Description: crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution

PDB Compounds: (L:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d1nlkl_:

Sequence; same for both SEQRES and ATOM records:

>d1nlkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]}
aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
lenakieiayffreteihsypyq

Timeline for d1nlkl_:

• d1nlkl_ first appeared (with stable ids) in SCOP 1.55
  
• d1nlkl_ appears in SCOP 1.71
  
• d1nlkl_ appears in SCOP 1.75
  
• d1nlkl_ appears in the current release, SCOPe 2.08