SCOPe 2.07: Domain d6ltvb1: 6ltv B:21-130

Lineage for d6ltvb1 (6ltv B:21-130)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (15 species)
   not a true protein

7. Species Cryptosporidium hominis [TaxId:237895] [256376] (3 PDB entries)

8. Domain d6ltvb1: 6ltv B:21-130 [391029]
   automated match to d4odja1
   complexed with 3po, eu9, mg

Details for d6ltvb1

PDB Entry: 6ltv, 1.87 Å

PDB Description: crystal structure of i122a/i330a variant of s-adenosylmethionine synthetase from cryptosporidium hominis in complex with onb-sam (2- nitro benzyme s-adenosyl-methionine)

PDB Compounds: (B:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d6ltvb1:

Sequence, based on SEQRES records:

>d6ltvb1 d.130.1.0 (B:21-130) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eqflfssesvcsghpdklcdqisdaildacleqdpesfvacetctktgfimvfgeittka
nvnyervvretvkeigydseekgldyktmdviikleqqsnqaagcvhvdk

Sequence, based on observed residues (ATOM records):

>d6ltvb1 d.130.1.0 (B:21-130) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eqflfssesvcsghpdklcdqisdaildacleqdpesfvacetctktgfimvfgeittka
nvnyervvretvkeigydseekgldyktmdviikleqqsnqhvdk

Timeline for d6ltvb1:

• d6ltvb1 is new in SCOPe 2.07-stable
  
• d6ltvb1 appears in the current release, SCOPe 2.08