Lineage for d6ltva1 (6ltv A:21-130)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583018Species Cryptosporidium hominis [TaxId:237895] [256376] (3 PDB entries)
  8. 2583028Domain d6ltva1: 6ltv A:21-130 [390980]
    automated match to d4odja1
    complexed with 3po, eu9, mg

Details for d6ltva1

PDB Entry: 6ltv (more details), 1.87 Å

PDB Description: crystal structure of i122a/i330a variant of s-adenosylmethionine synthetase from cryptosporidium hominis in complex with onb-sam (2- nitro benzyme s-adenosyl-methionine)
PDB Compounds: (A:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d6ltva1:

Sequence, based on SEQRES records: (download)

>d6ltva1 d.130.1.0 (A:21-130) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eqflfssesvcsghpdklcdqisdaildacleqdpesfvacetctktgfimvfgeittka
nvnyervvretvkeigydseekgldyktmdviikleqqsnqaagcvhvdk

Sequence, based on observed residues (ATOM records): (download)

>d6ltva1 d.130.1.0 (A:21-130) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eqflfssesvcsghpdklcdqisdaildacleqdpesfvacetctktgfimvfgeittka
nvnyervvretvkeigydseekgldyktmdviikleqqsnqhvdk

SCOPe Domain Coordinates for d6ltva1:

Click to download the PDB-style file with coordinates for d6ltva1.
(The format of our PDB-style files is described here.)

Timeline for d6ltva1: