Lineage for d4ln4g_ (4ln4 G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386207Species Influenza A virus [TaxId:1332244] [228093] (27 PDB entries)
  8. 2386264Domain d4ln4g_: 4ln4 G: [390916]
    Other proteins in same PDB: d4ln4b_, d4ln4d_, d4ln4f_, d4ln4h_, d4ln4j_, d4ln4l_
    automated match to d4d00c_
    complexed with nag

Details for d4ln4g_

PDB Entry: 4ln4 (more details), 3.1 Å

PDB Description: the crystal structure of hemagglutinin form a h7n9 influenza virus (a/shanghai/1/2013) in complex with lstb
PDB Compounds: (G:) Hemagglutinin

SCOPe Domain Sequences for d4ln4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ln4g_ b.19.1.0 (G:) automated matches {Influenza A virus [TaxId: 1332244]}
gdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgt
itgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysg
irtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgst
aeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfn
gafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpry
vkqrslllatgmknvp

SCOPe Domain Coordinates for d4ln4g_:

Click to download the PDB-style file with coordinates for d4ln4g_.
(The format of our PDB-style files is described here.)

Timeline for d4ln4g_: