Lineage for d4ln4f_ (4ln4 F:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646108Species Influenza A virus [TaxId:1332244] [256359] (11 PDB entries)
  8. 2646143Domain d4ln4f_: 4ln4 F: [390932]
    Other proteins in same PDB: d4ln4a_, d4ln4c_, d4ln4e_, d4ln4g_, d4ln4i_, d4ln4k_
    automated match to d3m5jb_
    complexed with nag

Details for d4ln4f_

PDB Entry: 4ln4 (more details), 3.1 Å

PDB Description: the crystal structure of hemagglutinin form a h7n9 influenza virus (a/shanghai/1/2013) in complex with lstb
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4ln4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ln4f_ h.3.1.1 (F:) automated matches {Influenza A virus [TaxId: 1332244]}
aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
lidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri

SCOPe Domain Coordinates for d4ln4f_:

Click to download the PDB-style file with coordinates for d4ln4f_.
(The format of our PDB-style files is described here.)

Timeline for d4ln4f_: