SCOPe 2.08: Domain d1nskt_: 1nsk T:

Lineage for d1nskt_ (1nsk T:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54922] (5 PDB entries)

8. Domain d1nskt_: 1nsk T: [39084]
   CASP1

Details for d1nskt_

PDB Entry: 1nsk, 2.8 Å

PDB Description: the crystal structure of a human nucleoside diphosphate kinase, nm23-h2

PDB Compounds: (T:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1nskt_:

Sequence; same for both SEQRES and ATOM records:

>d1nskt_ d.58.6.1 (T:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]}
manlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpf
fpglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
dsvksaekeislwfkpeelvdykscahdwvy

Timeline for d1nskt_:

• d1nskt_ first appeared (with stable ids) in SCOP 1.55
  
• d1nskt_ appears in SCOPe 2.07