Lineage for d1nskn_ (1nsk N:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951072Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2951127Species Human (Homo sapiens) [TaxId:9606] [54922] (5 PDB entries)
  8. 2951153Domain d1nskn_: 1nsk N: [39086]
    CASP1

Details for d1nskn_

PDB Entry: 1nsk (more details), 2.8 Å

PDB Description: the crystal structure of a human nucleoside diphosphate kinase, nm23-h2
PDB Compounds: (N:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1nskn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nskn_ d.58.6.1 (N:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]}
manlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpf
fpglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
dsvksaekeislwfkpeelvdykscahdwvy

SCOPe Domain Coordinates for d1nskn_:

Click to download the PDB-style file with coordinates for d1nskn_.
(The format of our PDB-style files is described here.)

Timeline for d1nskn_: