Lineage for d1nskr_ (1nsk R:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2173863Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2173864Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2173865Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2173920Species Human (Homo sapiens) [TaxId:9606] [54922] (5 PDB entries)
  8. 2173948Domain d1nskr_: 1nsk R: [39082]
    CASP1

Details for d1nskr_

PDB Entry: 1nsk (more details), 2.8 Å

PDB Description: the crystal structure of a human nucleoside diphosphate kinase, nm23-h2
PDB Compounds: (R:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1nskr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nskr_ d.58.6.1 (R:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]}
manlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpf
fpglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
dsvksaekeislwfkpeelvdykscahdwvy

SCOPe Domain Coordinates for d1nskr_:

Click to download the PDB-style file with coordinates for d1nskr_.
(The format of our PDB-style files is described here.)

Timeline for d1nskr_: