SCOPe 2.08: Domain d6l8fb_: 6l8f B:

Lineage for d6l8fb_ (6l8f B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.306: YefM-like [143119] (1 superfamily)
   core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet;

4. Superfamily d.306.1: YefM-like [143120] (2 families)

5. Family d.306.1.0: automated matches [191570] (1 protein)
   not a true family

6. Protein automated matches [190989] (3 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [390796] (1 PDB entry)

8. Domain d6l8fb_: 6l8f B: [390822]
   Other proteins in same PDB: d6l8fa2, d6l8fc_, d6l8fd_, d6l8ff2, d6l8fg_, d6l8fh_
   automated match to d3ctob_

Details for d6l8fb_

PDB Entry: 6l8f, 2.4 Å

PDB Description: crystal structure of heterotetrameric complex of yoeb-yefm toxin- antitoxin from staphylococcus aureus.

PDB Compounds: (B:) Antitoxin

SCOPe Domain Sequences for d6l8fb_:

Sequence; same for both SEQRES and ATOM records:

>d6l8fb_ d.306.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]}
miiknysyarqnlkalmtkvnddsdmvtvtstddknvvimsesdynsmmetlylqqnpnn
aehlaqsiadlergktitkdidv

Timeline for d6l8fb_:

• d6l8fb_ first appeared in SCOPe 2.07