Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein automated matches [190068] (13 species) not a true protein |
Species Streptomyces avermitilis [TaxId:227882] [390793] (1 PDB entry) |
Domain d6l69a_: 6l69 A: [390809] automated match to d1gwia_ complexed with hem |
PDB Entry: 6l69 (more details), 1.5 Å
SCOPe Domain Sequences for d6l69a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l69a_ a.104.1.1 (A:) automated matches {Streptomyces avermitilis [TaxId: 227882]} trialdpfvsdleaesaalraagplaavelpggvpvwavthhaeakklltdprlvkdinv wgawqrgeiapdwpliglanpgrsmltvdgadhrrmrtlvaqaltprrveqmreritklt eelldrltgevvdlkadfayplpmyvvadlmgidearlprlgelfekffstqtppaevia tltelagimaetvaakraapgddltsalilasedgdhltdaeivstlqlmvaaghettis livnavvnlsthpeqralvlsgeadwssvveetlrystptshvlirfatedvpvgdkvlp agdalivsygalgrdeaahgptagefditrstenrhisfghgphvcpgaalsrleagval palyarfpkldlavpaaelrnkpvvtqndlfelpvrlg
Timeline for d6l69a_: