Lineage for d1racd1 (1rac D:1-100)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192073Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 192074Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 192075Protein Aspartate carbamoyltransferase [54895] (1 species)
  7. 192076Species Escherichia coli [TaxId:562] [54896] (26 PDB entries)
  8. 192102Domain d1racd1: 1rac D:1-100 [39040]
    Other proteins in same PDB: d1raca1, d1raca2, d1racb2, d1racc1, d1racc2, d1racd2

Details for d1racd1

PDB Entry: 1rac (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1racd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1racd1 d.58.2.1 (D:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1racd1:

Click to download the PDB-style file with coordinates for d1racd1.
(The format of our PDB-style files is described here.)

Timeline for d1racd1: