Lineage for d1racc1 (1rac C:1-150)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 185200Fold c.78: ATC-like [53670] (2 superfamilies)
  4. 185201Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 185202Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 185203Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)
  7. 185211Species Escherichia coli [TaxId:562] [53674] (28 PDB entries)
  8. 185274Domain d1racc1: 1rac C:1-150 [35150]
    Other proteins in same PDB: d1racb1, d1racb2, d1racd1, d1racd2

Details for d1racc1

PDB Entry: 1rac (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1racc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1racc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOP Domain Coordinates for d1racc1:

Click to download the PDB-style file with coordinates for d1racc1.
(The format of our PDB-style files is described here.)

Timeline for d1racc1: