Lineage for d1rabb1 (1rab B:1-100)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133437Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 133438Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 133439Protein Aspartate carbamoyltransferase [54895] (1 species)
  7. 133440Species Escherichia coli [TaxId:562] [54896] (26 PDB entries)
  8. 133463Domain d1rabb1: 1rab B:1-100 [39035]
    Other proteins in same PDB: d1raba1, d1raba2, d1rabb2, d1rabc1, d1rabc2, d1rabd2

Details for d1rabb1

PDB Entry: 1rab (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1rabb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rabb1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1rabb1:

Click to download the PDB-style file with coordinates for d1rabb1.
(The format of our PDB-style files is described here.)

Timeline for d1rabb1: