Lineage for d1rabc2 (1rab C:151-310)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127168Fold c.78: ATC-like [53670] (2 superfamilies)
  4. 127169Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 127170Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (2 proteins)
  6. 127171Protein Aspartate carbamoyltransferase catalytic subunit [53673] (2 species)
  7. 127179Species Escherichia coli [TaxId:562] [53674] (28 PDB entries)
  8. 127239Domain d1rabc2: 1rab C:151-310 [35143]
    Other proteins in same PDB: d1rabb1, d1rabb2, d1rabd1, d1rabd2

Details for d1rabc2

PDB Entry: 1rab (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1rabc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rabc2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOP Domain Coordinates for d1rabc2:

Click to download the PDB-style file with coordinates for d1rabc2.
(The format of our PDB-style files is described here.)

Timeline for d1rabc2: