Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) Pfam PF06596 |
Family f.23.40.1: PsbX-like [267615] (2 proteins) |
Protein automated matches [267680] (2 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (26 PDB entries) |
Domain d6jllx_: 6jll x: [390256] Other proteins in same PDB: d6jlla_, d6jllb_, d6jllc_, d6jlle_, d6jllf_, d6jllh_, d6jlli_, d6jllj_, d6jllk_, d6jlll_, d6jllm_, d6jllo_, d6jllt_, d6jllu_, d6jllv_, d6jllz_ automated match to d4il6x_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jll (more details), 2.15 Å
SCOPe Domain Sequences for d6jllx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jllx_ f.23.40.1 (x:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} titpslkgffigllsgavvlgltfavliaisqidkvqr
Timeline for d6jllx_: