Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) automatically mapped to Pfam PF00421 |
Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
Protein automated matches [191285] (5 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (35 PDB entries) |
Domain d6jllb_: 6jll B: [390216] Other proteins in same PDB: d6jlla_, d6jlle_, d6jllf_, d6jllh_, d6jlli_, d6jllj_, d6jllk_, d6jlll_, d6jllm_, d6jllo_, d6jllt_, d6jllu_, d6jllv_, d6jllx_, d6jllz_ automated match to d4il6b_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jll (more details), 2.15 Å
SCOPe Domain Sequences for d6jllb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jllb_ f.55.1.1 (B:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg idpelspeqvewgfyqkvgdvttr
Timeline for d6jllb_: