SCOP 1.61: Domain d5at1b1: 5at1 B:8-100

Lineage for d5at1b1 (5at1 B:8-100)

Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family)
Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
Protein Aspartate carbamoyltransferase [54895] (1 species)
Species Escherichia coli [TaxId:562] [54896] (26 PDB entries)
Domain d5at1b1: 5at1 B:8-100 [39021]
Other proteins in same PDB: d5at1a1, d5at1a2, d5at1b2, d5at1c1, d5at1c2, d5at1d2

Details for d5at1b1

PDB Entry: 5at1 (more details), 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

SCOP Domain Sequences for d5at1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5at1b1 d.58.2.1 (B:8-100) Aspartate carbamoyltransferase {Escherichia coli}
gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d5at1b1:

Click to download the PDB-style file with coordinates for d5at1b1.
(The format of our PDB-style files is described here.)

Timeline for d5at1b1: