SCOPe 2.08: Domain d5at1b1: 5at1 B:8-100

Lineage for d5at1b1 (5at1 B:8-100)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families)
   automatically mapped to Pfam PF01948

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (3 species)

7. Species Escherichia coli [TaxId:562] [54896] (62 PDB entries)
   Uniprot P00478

8. Domain d5at1b1: 5at1 B:8-100 [39021]
   Other proteins in same PDB: d5at1a1, d5at1a2, d5at1b2, d5at1c1, d5at1c2, d5at1d2
   complexed with ctp, zn

Details for d5at1b1

PDB Entry: 5at1, 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d5at1b1:

Sequence; same for both SEQRES and ATOM records:

>d5at1b1 d.58.2.1 (B:8-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

Timeline for d5at1b1:

• d5at1b1 first appeared (with stable ids) in SCOP 1.55
  
• d5at1b1 appears in SCOPe 2.07