SCOPe 2.08: Domain d5at1c1: 5at1 C:1-150

Lineage for d5at1c1 (5at1 C:1-150)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)

7. Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
   Uniprot P00479

8. Domain d5at1c1: 5at1 C:1-150 [35118]
   Other proteins in same PDB: d5at1b1, d5at1b2, d5at1d1, d5at1d2
   complexed with ctp, zn

Details for d5at1c1

PDB Entry: 5at1, 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

PDB Compounds: (C:) aspartate carbamoyltransferase (t state), catalytic chain

SCOPe Domain Sequences for d5at1c1:

Sequence; same for both SEQRES and ATOM records:

>d5at1c1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqqteg

Timeline for d5at1c1:

• d5at1c1 first appeared (with stable ids) in SCOP 1.55
  
• d5at1c1 appears in SCOPe 2.07