SCOPe 2.08: Domain d7bt5b1: 7bt5 B:78-228

Lineage for d7bt5b1 (7bt5 B:78-228)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [389673] (1 PDB entry)

8. Domain d7bt5b1: 7bt5 B:78-228 [389712]
   Other proteins in same PDB: d7bt5a2, d7bt5b2
   automated match to d3bjua1
   protein/RNA complex; complexed with f6o, lys

Details for d7bt5b1

PDB Entry: 7bt5, 2.49 Å

PDB Description: crystal structure of plasmodium lysrs complexing with an antitumor compound

PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d7bt5b1:

Sequence, based on SEQRES records:

>d7bt5b1 b.40.4.0 (B:78-228) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
vdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitg
rimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpg
kskkgelsifpketillsaclhmlpmkyglk

Sequence, based on observed residues (ATOM records):

>d7bt5b1 b.40.4.0 (B:78-228) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
vdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitg
rimrvsaqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
kkgelsifpketillsaclhmlpmkyglk

Timeline for d7bt5b1:

• d7bt5b1 first appeared in SCOPe 2.07