Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Plasmodium falciparum [TaxId:5833] [389673] (1 PDB entry) |
Domain d7bt5b1: 7bt5 B:78-228 [389712] Other proteins in same PDB: d7bt5a2, d7bt5b2 automated match to d3bjua1 protein/RNA complex; complexed with f6o, lys |
PDB Entry: 7bt5 (more details), 2.49 Å
SCOPe Domain Sequences for d7bt5b1:
Sequence, based on SEQRES records: (download)
>d7bt5b1 b.40.4.0 (B:78-228) automated matches {Plasmodium falciparum [TaxId: 5833]} vdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitg rimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpg kskkgelsifpketillsaclhmlpmkyglk
>d7bt5b1 b.40.4.0 (B:78-228) automated matches {Plasmodium falciparum [TaxId: 5833]} vdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitg rimrvsaqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks kkgelsifpketillsaclhmlpmkyglk
Timeline for d7bt5b1: