Lineage for d7bt5b1 (7bt5 B:78-228)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400189Species Plasmodium falciparum [TaxId:5833] [389673] (1 PDB entry)
  8. 2400191Domain d7bt5b1: 7bt5 B:78-228 [389712]
    Other proteins in same PDB: d7bt5a2, d7bt5b2
    automated match to d3bjua1
    protein/RNA complex; complexed with f6o, lys

Details for d7bt5b1

PDB Entry: 7bt5 (more details), 2.49 Å

PDB Description: crystal structure of plasmodium lysrs complexing with an antitumor compound
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d7bt5b1:

Sequence, based on SEQRES records: (download)

>d7bt5b1 b.40.4.0 (B:78-228) automated matches {Plasmodium falciparum [TaxId: 5833]}
vdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitg
rimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpg
kskkgelsifpketillsaclhmlpmkyglk

Sequence, based on observed residues (ATOM records): (download)

>d7bt5b1 b.40.4.0 (B:78-228) automated matches {Plasmodium falciparum [TaxId: 5833]}
vdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitg
rimrvsaqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
kkgelsifpketillsaclhmlpmkyglk

SCOPe Domain Coordinates for d7bt5b1:

Click to download the PDB-style file with coordinates for d7bt5b1.
(The format of our PDB-style files is described here.)

Timeline for d7bt5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7bt5b2