Lineage for d7bv4a_ (7bv4 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932720Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2932721Protein GABA(A) receptor associated protein GABARAP [69658] (3 species)
  7. 2932722Species Human (Homo sapiens) [TaxId:9606] [69659] (9 PDB entries)
  8. 2932728Domain d7bv4a_: 7bv4 A: [389687]
    automated match to d1gnua_
    complexed with gol, peg

Details for d7bv4a_

PDB Entry: 7bv4 (more details), 2 Å

PDB Description: crystal structure of stx17 lir region in complex with gabarap
PDB Compounds: (A:) Gamma-aminobutyric acid receptor-associated protein

SCOPe Domain Sequences for d7bv4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bv4a_ d.15.1.3 (A:) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]}
mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysde

SCOPe Domain Coordinates for d7bv4a_:

Click to download the PDB-style file with coordinates for d7bv4a_.
(The format of our PDB-style files is described here.)

Timeline for d7bv4a_: