| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins automatically mapped to Pfam PF02991 |
| Protein GABA(A) receptor associated protein GABARAP [69658] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69659] (9 PDB entries) |
| Domain d7bv4b_: 7bv4 B: [389677] automated match to d1gnua_ complexed with gol, peg |
PDB Entry: 7bv4 (more details), 2 Å
SCOPe Domain Sequences for d7bv4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bv4b_ d.15.1.3 (B:) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]}
mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysde
Timeline for d7bv4b_: