Lineage for d1g6ba_ (1g6b A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1026489Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 1026514Family d.58.1.2: 7-Fe ferredoxin [54870] (2 proteins)
    has C-terminal extension to the common fold
  6. 1026515Protein Ferredoxin [54871] (3 species)
  7. 1026516Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries)
  8. 1026531Domain d1g6ba_: 1g6b A: [38963]
    complexed with f3s, sf4; mutant

Details for d1g6ba_

PDB Entry: 1g6b (more details), 1.9 Å

PDB Description: crystal structure of p47s mutant of ferredoxin i
PDB Compounds: (A:) 7fe ferredoxin I

SCOPe Domain Sequences for d1g6ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6ba_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}
afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcesecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

SCOPe Domain Coordinates for d1g6ba_:

Click to download the PDB-style file with coordinates for d1g6ba_.
(The format of our PDB-style files is described here.)

Timeline for d1g6ba_: