SCOPe 2.08: Domain d1g6ba_: 1g6b A:

Lineage for d1g6ba_ (1g6b A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
   has C-terminal extension to the common fold

6. Protein Ferredoxin [54871] (3 species)

7. Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries)

8. Domain d1g6ba_: 1g6b A: [38963]
   complexed with f3s, sf4; mutant

Details for d1g6ba_

PDB Entry: 1g6b, 1.9 Å

PDB Description: crystal structure of p47s mutant of ferredoxin i

PDB Compounds: (A:) 7fe ferredoxin I

SCOPe Domain Sequences for d1g6ba_:

Sequence; same for both SEQRES and ATOM records:

>d1g6ba_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}
afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcesecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

Timeline for d1g6ba_:

• d1g6ba_ first appeared (with stable ids) in SCOP 1.55
  
• d1g6ba_ appears in SCOPe 2.07