Lineage for d1d3wa_ (1d3w A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650134Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1650159Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 1650160Protein Ferredoxin [54871] (3 species)
  7. 1650161Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries)
  8. 1650168Domain d1d3wa_: 1d3w A: [38957]
    complexed with f3s, sf4; mutant

Details for d1d3wa_

PDB Entry: 1d3w (more details), 1.7 Å

PDB Description: Crystal structure of ferredoxin 1 d15e mutant from azotobacter vinelandii at 1.7 angstrom resolution.
PDB Compounds: (A:) ferredoxin 1

SCOPe Domain Sequences for d1d3wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3wa_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}
afvvtdncikckytecvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

SCOPe Domain Coordinates for d1d3wa_:

Click to download the PDB-style file with coordinates for d1d3wa_.
(The format of our PDB-style files is described here.)

Timeline for d1d3wa_: