SCOPe 2.05: Domain d1d3wa_: 1d3w A:

Lineage for d1d3wa_ (1d3w A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
   has C-terminal extension to the common fold

6. Protein Ferredoxin [54871] (3 species)

7. Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries)

8. Domain d1d3wa_: 1d3w A: [38957]
   complexed with f3s, sf4; mutant

Details for d1d3wa_

PDB Entry: 1d3w, 1.7 Å

PDB Description: Crystal structure of ferredoxin 1 d15e mutant from azotobacter vinelandii at 1.7 angstrom resolution.

PDB Compounds: (A:) ferredoxin 1

SCOPe Domain Sequences for d1d3wa_:

Sequence; same for both SEQRES and ATOM records:

>d1d3wa_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}
afvvtdncikckytecvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

Timeline for d1d3wa_:

• d1d3wa_ first appeared (with stable ids) in SCOP 1.55
  
• d1d3wa_ appears in SCOPe 2.04
  
• d1d3wa_ appears in SCOPe 2.06
  
• d1d3wa_ appears in the current release, SCOPe 2.08