SCOPe 2.04: Domain d1blua_: 1blu A:

Lineage for d1blua_ (1blu A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.1: Short-chain ferredoxins [54863] (2 proteins)
   contains two 4Fe-4S clusters

6. Protein Ferredoxin II [54864] (5 species)

7. Species Chromatium vinosum [TaxId:1049] [54869] (1 PDB entry)

8. Domain d1blua_: 1blu A: [38948]
   complexed with sf4

Details for d1blua_

PDB Entry: 1blu, 2.1 Å

PDB Description: structure of the 2[4fe-4s] ferredoxin from chromatium vinosum

PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1blua_:

Sequence; same for both SEQRES and ATOM records:

>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]}
almitdecincdvcepecpngaisqgdetyviepslctecvghyetsqcvevcpvdciik
dpsheetedelrakyeritg

Timeline for d1blua_:

• d1blua_ first appeared (with stable ids) in SCOP 1.55, called d1blu__
  
• d1blua_ appears in SCOPe 2.03
  
• d1blua_ appears in SCOPe 2.05
  
• d1blua_ appears in the current release, SCOPe 2.08