![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) ![]() |
![]() | Family d.58.1.1: Short-chain ferredoxins [54863] (1 protein) |
![]() | Protein Ferredoxin II [54864] (5 species) |
![]() | Species Chromatium vinosum [TaxId:1049] [54869] (1 PDB entry) |
![]() | Domain d1blu__: 1blu - [38948] |
PDB Entry: 1blu (more details), 2.1 Å
SCOP Domain Sequences for d1blu__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1blu__ d.58.1.1 (-) Ferredoxin II {Chromatium vinosum} almitdecincdvcepecpngaisqgdetyviepslctecvghyetsqcvevcpvdciik dpsheetedelrakyeritg
Timeline for d1blu__: