Lineage for d1blu__ (1blu -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32367Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 32368Family d.58.1.1: Short-chain ferredoxins [54863] (1 protein)
  6. 32369Protein Ferredoxin II [54864] (5 species)
  7. 32370Species Chromatium vinosum [TaxId:1049] [54869] (1 PDB entry)
  8. 32371Domain d1blu__: 1blu - [38948]

Details for d1blu__

PDB Entry: 1blu (more details), 2.1 Å

PDB Description: structure of the 2[4fe-4s] ferredoxin from chromatium vinosum

SCOP Domain Sequences for d1blu__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blu__ d.58.1.1 (-) Ferredoxin II {Chromatium vinosum}
almitdecincdvcepecpngaisqgdetyviepslctecvghyetsqcvevcpvdciik
dpsheetedelrakyeritg

SCOP Domain Coordinates for d1blu__:

Click to download the PDB-style file with coordinates for d1blu__.
(The format of our PDB-style files is described here.)

Timeline for d1blu__: