Lineage for d6wjcc1 (6wjc C:1-65)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032326Protein automated matches [190676] (9 species)
    not a true protein
  7. 3032332Species Green mamba (Dendroaspis angusticeps) [TaxId:8618] [197029] (2 PDB entries)
  8. 3032334Domain d6wjcc1: 6wjc C:1-65 [389066]
    Other proteins in same PDB: d6wjcc2
    automated match to d1ff4a_
    complexed with acm, oin, y01

Details for d6wjcc1

PDB Entry: 6wjc (more details), 2.55 Å

PDB Description: muscarinic acetylcholine receptor 1 - muscarinic toxin 7 complex
PDB Compounds: (C:) Muscarinic toxin 7

SCOPe Domain Sequences for d6wjcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wjcc1 g.7.1.1 (C:1-65) automated matches {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]}
ltcvksnsiwfptsedcpdgqnlcfkrwqyisprmydftrgcaatcpkaeyrdvinccgt
dkcnk

SCOPe Domain Coordinates for d6wjcc1:

Click to download the PDB-style file with coordinates for d6wjcc1.
(The format of our PDB-style files is described here.)

Timeline for d6wjcc1:

3032334
d6wjcc1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6wjcc2