PDB entry 6wjc

View 6wjc on RCSB PDB site
Description: Muscarinic acetylcholine receptor 1 - muscarinic toxin 7 complex
Class: membrane protein
Keywords: GPCR, natural toxin, MEMBRANE PROTEIN
Deposited on 2020-04-13, released 2020-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-22, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muscarinic acetylcholine receptor M1,Endolysin fusion
    Species: Homo sapiens [TaxId:9606]
    Gene: CHRM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11229 (Start-226)
      • conflict (118)
      • conflict (120)
    • Uniprot D9IEF7 (227-386)
      • conflict (279)
      • conflict (322)
    • Uniprot P11229 (387-End)
  • Chain 'C':
    Compound: Muscarinic toxin 7
    Species: Dendroaspis angusticeps [TaxId:8618]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8QGR0 (4-68)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d6wjcc1, d6wjcc2
  • Heterogens: OIN, Y01, ACM, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6wjcC (C:)
gpgsltcvksnsiwfptsedcpdgqnlcfkrwqyisprmydftrgcaatcpkaeyrdvin
ccgtdkcnk