SCOPe 2.08: Domain d6sesf1: 6ses F:1-76

Lineage for d6sesf1 (6ses F:1-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)

6. Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries)

8. Domain d6sesf1: 6ses F:1-76 [388994]
   Other proteins in same PDB: d6sesa1, d6sesa2, d6sesb1, d6sesb2, d6sesc1, d6sesc2, d6sesd1, d6sesd2, d6sese_, d6sesf2
   automated match to d3tiia1
   complexed with acp, gdp, gol, gtp, l95, mes, mg

Details for d6sesf1

PDB Entry: 6ses, 2 Å

PDB Description: tubulin-b2 complex

PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d6sesf1:

Sequence; same for both SEQRES and ATOM records:

>d6sesf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d6sesf1:

• d6sesf1 first appeared in SCOPe 2.07