SCOPe 2.08: Domain d6sesc1: 6ses C:1-245

Lineage for d6sesc1 (6ses C:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)

8. Domain d6sesc1: 6ses C:1-245 [388996]
   Other proteins in same PDB: d6sesa2, d6sesb2, d6sesc2, d6sesd2, d6sese_, d6sesf1, d6sesf2
   automated match to d5fnva1
   complexed with acp, gdp, gol, gtp, l95, mes, mg

Details for d6sesc1

PDB Entry: 6ses, 2 Å

PDB Description: tubulin-b2 complex

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6sesc1:

Sequence; same for both SEQRES and ATOM records:

>d6sesc1 c.32.1.1 (C:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d6sesc1:

• d6sesc1 first appeared in SCOPe 2.07