Lineage for d2chra2 (2chr A:1-126)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649015Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1649027Protein Chlormuconate cycloisomerase [54840] (2 species)
  7. 1649028Species Alcaligenes eutrophus [TaxId:106590] [54841] (1 PDB entry)
  8. 1649029Domain d2chra2: 2chr A:1-126 [38895]
    Other proteins in same PDB: d2chra1
    complexed with cl, mn

Details for d2chra2

PDB Entry: 2chr (more details), 3 Å

PDB Description: a re-evaluation of the crystal structure of chloromuconate cycloisomerase
PDB Compounds: (A:) chloromuconate cycloisomerase

SCOPe Domain Sequences for d2chra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2chra2 d.54.1.1 (A:1-126) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]}
mkidaieavivdvptkrpiqmsittvhqqsyvivrvyseglvgvgeggsvggpvwsaeca
etikiiverylaphllgtdafnvsgalqtmaravtgnasakaavemalldlkaralgvsi
aellgg

SCOPe Domain Coordinates for d2chra2:

Click to download the PDB-style file with coordinates for d2chra2.
(The format of our PDB-style files is described here.)

Timeline for d2chra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2chra1