![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein Chlormuconate cycloisomerase [54840] (2 species) |
![]() | Species Alcaligenes eutrophus [TaxId:106590] [54841] (1 PDB entry) |
![]() | Domain d2chra2: 2chr A:1-126 [38895] Other proteins in same PDB: d2chra1 complexed with cl, mn |
PDB Entry: 2chr (more details), 3 Å
SCOPe Domain Sequences for d2chra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2chra2 d.54.1.1 (A:1-126) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} mkidaieavivdvptkrpiqmsittvhqqsyvivrvyseglvgvgeggsvggpvwsaeca etikiiverylaphllgtdafnvsgalqtmaravtgnasakaavemalldlkaralgvsi aellgg
Timeline for d2chra2: