Lineage for d6m3bd1 (6m3b D:50-96)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031827Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 3031828Protein automated matches [226968] (5 species)
    not a true protein
  7. 3031829Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)
  8. 3031849Domain d6m3bd1: 6m3b D:50-96 [388916]
    Other proteins in same PDB: d6m3ba_, d6m3bb1, d6m3bb2, d6m3bc_
    automated match to d1autl1
    complexed with nag

Details for d6m3bd1

PDB Entry: 6m3b (more details), 2.2 Å

PDB Description: hapc-c25k23 fab complex
PDB Compounds: (D:) Vitamin K-dependent protein C light chain

SCOPe Domain Sequences for d6m3bd1:

Sequence, based on SEQRES records: (download)

>d6m3bd1 g.3.11.0 (D:50-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
clvlplehpcaslccghgtcidgigsfscdcrsgwegrfcqrevsfl

Sequence, based on observed residues (ATOM records): (download)

>d6m3bd1 g.3.11.0 (D:50-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
clvlplehpcaslccghgtcifscdcrsgwegrfcqrevsfl

SCOPe Domain Coordinates for d6m3bd1:

Click to download the PDB-style file with coordinates for d6m3bd1.
(The format of our PDB-style files is described here.)

Timeline for d6m3bd1: