SCOPe 2.08: Domain d6m3bd1: 6m3b D:50-96

Lineage for d6m3bd1 (6m3b D:50-96)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.0: automated matches [227227] (1 protein)
   not a true family

6. Protein automated matches [226968] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)

8. Domain d6m3bd1: 6m3b D:50-96 [388916]
   Other proteins in same PDB: d6m3ba_, d6m3bb1, d6m3bb2, d6m3bc_
   automated match to d1autl1
   complexed with nag

Details for d6m3bd1

PDB Entry: 6m3b, 2.2 Å

PDB Description: hapc-c25k23 fab complex

PDB Compounds: (D:) Vitamin K-dependent protein C light chain

SCOPe Domain Sequences for d6m3bd1:

Sequence, based on SEQRES records:

>d6m3bd1 g.3.11.0 (D:50-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
clvlplehpcaslccghgtcidgigsfscdcrsgwegrfcqrevsfl

Sequence, based on observed residues (ATOM records):

>d6m3bd1 g.3.11.0 (D:50-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
clvlplehpcaslccghgtcifscdcrsgwegrfcqrevsfl

Timeline for d6m3bd1:

• d6m3bd1 first appeared in SCOPe 2.07