SCOPe 2.07: Domain d6tzgd_: 6tzg D:

Lineage for d6tzgd_ (6tzg D:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [194613] (63 PDB entries)

8. Domain d6tzgd_: 6tzg D: [388281]
   automated match to d5w14b_
   complexed with pky

Details for d6tzgd_

PDB Entry: 6tzg, 1.82 Å

PDB Description: adc-7 in complex with boronic acid transition state inhibitor s17083

PDB Compounds: (D:) Beta-lactamase

SCOPe Domain Sequences for d6tzgd_:

Sequence; same for both SEQRES and ATOM records:

>d6tzgd_ e.3.1.0 (D:) automated matches {Acinetobacter baumannii [TaxId: 470]}
pkdqeikklvdqnfkpllekydvpgmavgviqnnkkyemyyglqsvqdkkavnsntifel
gsvsklftataggyaknkgkisfddtpgkywkelkntpidqvnllqlatytsgnlalqfp
devqtdqqvltffkdwkpknpigeyrqysnpsiglfgkvvalsmnkpfdqvlektifpal
glkhsyvnvpktqmqnyafgynqenqpirvnpgpldapaygvkstlpdmlsfihanlnpq
kyptdiqrainethqgryqvntmyqalgweefsypatlqtlldsnseqivmkpnkvtais
kepsvkmyhktgstsgfgtyvvfipkeniglvmltnkripneerikaayvvlnaik

Timeline for d6tzgd_:

• d6tzgd_ is new in SCOPe 2.07-stable
  
• d6tzgd_ appears in the current release, SCOPe 2.08