Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Acinetobacter baumannii [TaxId:470] [194613] (63 PDB entries) |
Domain d6tzga_: 6tzg A: [388279] automated match to d5w14b_ complexed with pky |
PDB Entry: 6tzg (more details), 1.82 Å
SCOPe Domain Sequences for d6tzga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tzga_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]} ntpkdqeikklvdqnfkpllekydvpgmavgviqnnkkyemyyglqsvqdkkavnsntif elgsvsklftataggyaknkgkisfddtpgkywkelkntpidqvnllqlatytsgnlalq fpdevqtdqqvltffkdwkpknpigeyrqysnpsiglfgkvvalsmnkpfdqvlektifp alglkhsyvnvpktqmqnyafgynqenqpirvnpgpldapaygvkstlpdmlsfihanln pqkyptdiqrainethqgryqvntmyqalgweefsypatlqtlldsnseqivmkpnkvta iskepsvkmyhktgstsgfgtyvvfipkeniglvmltnkripneerikaayvvlnaik
Timeline for d6tzga_: