Class b: All beta proteins [48724] (180 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (17 species) not a true protein |
Species Escherichia coli [TaxId:562] [388132] (2 PDB entries) |
Domain d6oqre1: 6oqr E:0-74 [388133] Other proteins in same PDB: d6oqrd2, d6oqrd3, d6oqre2, d6oqre3, d6oqrf2, d6oqrf3, d6oqrg_, d6oqrh1, d6oqrh2, d6oqri_, d6oqrj_, d6oqrl_, d6oqrm_, d6oqrn_, d6oqro_, d6oqrp_, d6oqrq_, d6oqrr_, d6oqrs_ automated match to d4q4la1 complexed with adp, atp, mg, po4 |
PDB Entry: 6oqr (more details), 3.1 Å
SCOPe Domain Sequences for d6oqre1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6oqre1 b.49.1.0 (E:0-74) automated matches {Escherichia coli [TaxId: 562]} matgkivqvigavvdvefpqdavprvydalevqngnerlvlevqqqlgggivrtiamgss dglrrgldvkdlehp
Timeline for d6oqre1: