SCOPe 2.08: Domain d6oqre1: 6oqr E:0-74

Lineage for d6oqre1 (6oqr E:0-74)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (17 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [388132] (2 PDB entries)

8. Domain d6oqre1: 6oqr E:0-74 [388133]
   Other proteins in same PDB: d6oqrd2, d6oqrd3, d6oqre2, d6oqre3, d6oqrf2, d6oqrf3, d6oqrg_, d6oqrh1, d6oqrh2, d6oqri_, d6oqrj_, d6oqrl_, d6oqrm_, d6oqrn_, d6oqro_, d6oqrp_, d6oqrq_, d6oqrr_, d6oqrs_
   automated match to d4q4la1
   complexed with adp, atp, mg, po4

Details for d6oqre1

PDB Entry: 6oqr, 3.1 Å

PDB Description: e. coli atp synthase adp state 1a

PDB Compounds: (E:) ATP synthase subunit beta

SCOPe Domain Sequences for d6oqre1:

Sequence; same for both SEQRES and ATOM records:

>d6oqre1 b.49.1.0 (E:0-74) automated matches {Escherichia coli [TaxId: 562]}
matgkivqvigavvdvefpqdavprvydalevqngnerlvlevqqqlgggivrtiamgss
dglrrgldvkdlehp

Timeline for d6oqre1:

• d6oqre1 first appeared in SCOPe 2.07