Lineage for d6oqrd2 (6oqr D:75-343)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871906Species Escherichia coli [TaxId:562] [226067] (7 PDB entries)
  8. 2871922Domain d6oqrd2: 6oqr D:75-343 [388181]
    Other proteins in same PDB: d6oqrd1, d6oqrd3, d6oqre1, d6oqre3, d6oqrf1, d6oqrf3, d6oqrg_, d6oqrh1, d6oqrh2, d6oqri_, d6oqrj_, d6oqrl_, d6oqrm_, d6oqrn_, d6oqro_, d6oqrp_, d6oqrq_, d6oqrr_, d6oqrs_
    automated match to d4q4la2
    complexed with adp, atp, mg, po4

Details for d6oqrd2

PDB Entry: 6oqr (more details), 3.1 Å

PDB Description: e. coli atp synthase adp state 1a
PDB Compounds: (D:) ATP synthase subunit beta

SCOPe Domain Sequences for d6oqrd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oqrd2 c.37.1.0 (D:75-343) automated matches {Escherichia coli [TaxId: 562]}
ievpvgkatlgrimnvlgepvdmkgeigeeerwaihraapsyeelsnsqelletgikvid
lmapfakggkvglfggagvgktvnmmelirniaiehsgysvfagvgertregndfyhemt
dsnvidkvslvygqmneppgnrlrvaltgltmaekfrdegrdvllfvdniyrytlagtev
sallgrmpsavgyqptlaeemgvlqeritstktgsitsvqavyvpaddltdpspattfah
ldatvvlsrqiaslgiypavdpldstsrq

SCOPe Domain Coordinates for d6oqrd2:

Click to download the PDB-style file with coordinates for d6oqrd2.
(The format of our PDB-style files is described here.)

Timeline for d6oqrd2: