SCOPe 2.08: Domain d6oqrj_: 6oqr J:

Lineage for d6oqrj_ (6oqr J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.1: Rotary ATPase ring subunits [81333] (2 families)
   automatically mapped to Pfam PF00137

5. Family f.17.1.1: F1F0 ATP synthase subunit C or V-type proton ATPase subunit c [81332] (3 proteins)

6. Protein automated matches [367200] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [386971] (4 PDB entries)

8. Domain d6oqrj_: 6oqr J: [388141]
   Other proteins in same PDB: d6oqrd1, d6oqrd2, d6oqrd3, d6oqre1, d6oqre2, d6oqre3, d6oqrf1, d6oqrf2, d6oqrf3, d6oqrg_, d6oqrh1, d6oqrh2
   automated match to d1l6ta_
   complexed with adp, atp, mg, po4

Details for d6oqrj_

PDB Entry: 6oqr, 3.1 Å

PDB Description: e. coli atp synthase adp state 1a

PDB Compounds: (J:) ATP synthase subunit c

SCOPe Domain Sequences for d6oqrj_:

Sequence; same for both SEQRES and ATOM records:

>d6oqrj_ f.17.1.1 (J:) automated matches {Escherichia coli [TaxId: 562]}
nlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglvda
ipmiavglglyvmfava

Timeline for d6oqrj_:

• d6oqrj_ first appeared in SCOPe 2.07